Lineage for d1uola_ (1uol A:)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) 
Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins) Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49420] (13 PDB entries) 
Domain d1uola_: 1uol A: [99695]
Details for d1uola_
PDB Entry: 1uol (more details), 1.9 Å
PDB Description: crystal structure of the human p53 core domain mutant m133l/v203a/n239y/n268d at 1.9 a resolution.
PDB Compounds: (A:) Cellular tumor antigen p53SCOP Domain Sequences for d1uola_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uola_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnklfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfrhs
vvvpyeppevgsdcttihynymcysscmggmnrrpiltiitledssgnllgrdsfevrvc
acpgrdrrteeenlr
SCOP Domain Coordinates for d1uola_:
Click to download the PDB-style file with coordinates for d1uola_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uola_:
- d1uola_ first appeared in SCOP 1.67
- d1uola_ appears in SCOP 1.73
- d1uola_ appears in SCOPe 2.01
- d1uola_ appears in the current release, SCOPe 2.08
View in 3D
