Lineage for d1uoka1 (1uok A:480-558)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2077254Protein Oligo-1,6-glucosidase [51042] (1 species)
  7. 2077255Species Bacillus cereus [TaxId:1396] [51043] (1 PDB entry)
  8. 2077256Domain d1uoka1: 1uok A:480-558 [27801]
    Other proteins in same PDB: d1uoka2

Details for d1uoka1

PDB Entry: 1uok (more details), 2 Å

PDB Description: crystal structure of b. cereus oligo-1,6-glucosidase
PDB Compounds: (A:) oligo-1,6-glucosidase

SCOPe Domain Sequences for d1uoka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uoka1 b.71.1.1 (A:480-558) Oligo-1,6-glucosidase {Bacillus cereus [TaxId: 1396]}
gsydlilennpsifayvrtygvekllvianftaeecifelpedisysevellihnydven
gpienitlrpyeamvfklk

SCOPe Domain Coordinates for d1uoka1:

Click to download the PDB-style file with coordinates for d1uoka1.
(The format of our PDB-style files is described here.)

Timeline for d1uoka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uoka2