Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Oligo-1,6-glucosidase [51042] (1 species) |
Species Bacillus cereus [TaxId:1396] [51043] (1 PDB entry) |
Domain d1uoka1: 1uok A:480-558 [27801] Other proteins in same PDB: d1uoka2 |
PDB Entry: 1uok (more details), 2 Å
SCOPe Domain Sequences for d1uoka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uoka1 b.71.1.1 (A:480-558) Oligo-1,6-glucosidase {Bacillus cereus [TaxId: 1396]} gsydlilennpsifayvrtygvekllvianftaeecifelpedisysevellihnydven gpienitlrpyeamvfklk
Timeline for d1uoka1: