Lineage for d1unqa_ (1unq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803238Protein Rac-alpha serine/threonine kinase [89355] (1 species)
  7. 2803239Species Human (Homo sapiens) [TaxId:9606] [89356] (4 PDB entries)
    Uniprot P31749 1-117
  8. 2803240Domain d1unqa_: 1unq A: [107968]
    complexed with 4ip

Details for d1unqa_

PDB Entry: 1unq (more details), 0.98 Å

PDB Description: high resolution crystal structure of the pleckstrin homology domain of protein kinase b/akt bound to ins(1,3,4,5)-tetrakisphophate
PDB Compounds: (A:) rac-alpha serine/threonine kinase

SCOPe Domain Sequences for d1unqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]}
smsdvaivkegwlhkrgeyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaq
cqlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeee

SCOPe Domain Coordinates for d1unqa_:

Click to download the PDB-style file with coordinates for d1unqa_.
(The format of our PDB-style files is described here.)

Timeline for d1unqa_: