Lineage for d1un0b_ (1un0 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725423Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 2725528Protein Karyopherin alpha [48383] (2 species)
  7. 2725529Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48384] (6 PDB entries)
    Uniprot Q02821 12-514
  8. 2725537Domain d1un0b_: 1un0 B: [99642]
    complexed with a nup2p N-terminal fragment, chains C and D

Details for d1un0b_

PDB Entry: 1un0 (more details), 2.6 Å

PDB Description: crystal structure of yeast karyopherin (importin) alpha in complex with a nup2p n-terminal fragment
PDB Compounds: (B:) importin alpha subunit

SCOPe Domain Sequences for d1un0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1un0b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
lvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
yfgeeedavdetmapqnag

SCOPe Domain Coordinates for d1un0b_:

Click to download the PDB-style file with coordinates for d1un0b_.
(The format of our PDB-style files is described here.)

Timeline for d1un0b_: