Lineage for d1umvx_ (1umv X:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649171Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 649172Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 649177Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 649265Protein Snake phospholipase A2 [48624] (35 species)
  7. 649328Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [101487] (4 PDB entries)
  8. 649331Domain d1umvx_: 1umv X: [99630]
    acidic, non-myotoxic phospholipase A2
    complexed with ca

Details for d1umvx_

PDB Entry: 1umv (more details), 1.79 Å

PDB Description: crystal structure of an acidic, non-myotoxic phospholipase a2 from the venom of bothrops jararacussu
PDB Compounds: (X:) hypotensive phospholipase A2

SCOP Domain Sequences for d1umvx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umvx_ a.133.1.2 (X:) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcnpk
idsytyskkngdvvcggdnpckkqicecdrvattcfrdnkdtydikywfygakncqekse
pc

SCOP Domain Coordinates for d1umvx_:

Click to download the PDB-style file with coordinates for d1umvx_.
(The format of our PDB-style files is described here.)

Timeline for d1umvx_: