SCOPe 2.07: Domain d1ulqa1: 1ulq A:3-275

Lineage for d1ulqa1 (1ulq A:3-275)

Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (3 families)
Family c.95.1.1: Thiolase-related [53902] (10 proteins)
Protein Beta-ketoadipyl CoA thiolase [117750] (1 species)
Species Thermus thermophilus [TaxId:274] [117751] (1 PDB entry)
Uniprot Q5SJM1
Domain d1ulqa1: 1ulq A:3-275 [113267]
Structural genomics target

Details for d1ulqa1

PDB Entry: 1ulq (more details), 3 Å

PDB Description: Crystal structure of tt0182 from Thermus thermophilus HB8

PDB Compounds: (A:) putative acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1ulqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]}
eawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqaged
nrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsra
pyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeqd
rfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvfr
eggtvtagnssplndgaaavllvsddyakahgl

SCOPe Domain Coordinates for d1ulqa1:

Click to download the PDB-style file with coordinates for d1ulqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ulqa1: