Lineage for d1ujka_ (1ujk A:)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) 
Family a.118.9.2: VHS domain [48468] (6 proteins) 
Protein ADP-ribosylation factor binding protein Gga1 [74782] (1 species) Species Human (Homo sapiens) [TaxId:9606] [74783] (5 PDB entries) 
Domain d1ujka_: 1ujk A: [99457]
complexed with beta-secretase C-terminal phosphopeptide
complexed with iod
Details for d1ujka_
PDB Entry: 1ujk (more details), 1.9 Å
PDB Description: VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE
PDB Compounds: (A:) ADP-ribosylation factor binding protein GGA1SCOPe Domain Sequences for d1ujka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
epamepetlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqew
eaiqaltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellys
wtvglpeevkiaeayqmlkkqgivk
SCOPe Domain Coordinates for d1ujka_:
Click to download the PDB-style file with coordinates for d1ujka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ujka_:
- d1ujka_ first appeared in SCOP 1.67
- d1ujka_ appears in SCOPe 2.05
- d1ujka_ appears in SCOPe 2.07
- d1ujka_ appears in the current release, SCOPe 2.08
View in 3D
