Lineage for d1uj2a_ (1uj2 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins) Protein Uridine-cytidine kinase 2 [102360] (1 species) Species Human (Homo sapiens) [TaxId:9606] [102361] (6 PDB entries) 
Domain d1uj2a_: 1uj2 A: [99452]
complexed with adp, c5p, mg
Details for d1uj2a_
PDB Entry: 1uj2 (more details), 1.8 Å
PDB Description: Crystal structure of human uridine-cytidine kinase 2 complexed with products, CMP and ADP
PDB Compounds: (A:) Uridine-cytidine kinase 2SCOPe Domain Sequences for d1uj2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
ptkkyadviiprgadnlvainlivqhiqdilng
SCOPe Domain Coordinates for d1uj2a_:
Click to download the PDB-style file with coordinates for d1uj2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uj2a_:
- d1uj2a_ first appeared in SCOP 1.67
- d1uj2a_ appears in SCOPe 2.04
- d1uj2a_ appears in SCOPe 2.06
- d1uj2a_ appears in the current release, SCOPe 2.08
View in 3D
