Lineage for d1uiya_ (1uiy A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 981011Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 981108Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species)
  7. 981134Species Thermus thermophilus [TaxId:274] [102207] (1 PDB entry)
  8. 981135Domain d1uiya_: 1uiy A: [99448]
    complexed with dio, gol

Details for d1uiya_

PDB Entry: 1uiy (more details), 2.85 Å

PDB Description: crystal structure of enoyl-coa hydratase from thermus thermophilus hb8
PDB Compounds: (A:) enoyl-coa hydratase

SCOPe Domain Sequences for d1uiya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]}
mvqvekghvavvflndperrnplspemalsllqalddleadpgvravvltgrgkafsaga
dlaflervtelgaeenyrhslslmrlfhrvytypkptvaavngpavaggaglalacdlvv
mdeearlgytevkigfvaalvsvilvravgekaakdllltgrlveareakalglvnriap
pgkaleeakalaeevaknaptslrltkelllalpgmgledgfrlaalanawvretgdlae
giraffekrpprf

SCOPe Domain Coordinates for d1uiya_:

Click to download the PDB-style file with coordinates for d1uiya_.
(The format of our PDB-style files is described here.)

Timeline for d1uiya_: