Lineage for d1uiva_ (1uiv A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) 
Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
similar domain organization to oligo- and dipeptide-binding proteinSpecies Escherichia coli [TaxId:562] [102695] (28 PDB entries) 
Domain d1uiva_: 1uiv A: [99436]
complexed with ni
Details for d1uiva_
PDB Entry: 1uiv (more details), 1.95 Å
PDB Description: crystal structures of the liganded and unliganded nickel binding protein nika from escherichia coli (nickel liganded form)
PDB Compounds: (A:) Nickel-binding periplasmic proteinSCOPe Domain Sequences for d1uiva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uiva_ c.94.1.1 (A:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
deittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgktw
tftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitlk
sayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrnen
ywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtqls
qpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyanl
glkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiirad
mrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaqq
gladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgni
pyapiateipfeqikpv
SCOPe Domain Coordinates for d1uiva_:
Click to download the PDB-style file with coordinates for d1uiva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uiva_:
- d1uiva_ first appeared in SCOP 1.67
- d1uiva_ appears in SCOPe 2.06
- d1uiva_ appears in the current release, SCOPe 2.08
View in 3D
