Lineage for d1uisa_ (1uis A:)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.22: GFP-like [54510] (1 superfamily)
beta-sheet folds into a barrel (n=11, S=14) around the central helixSuperfamily d.22.1: GFP-like [54511] (3 families) 
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) 
Protein Red fluorescent protein fp61 [102854] (1 species) Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [102855] (1 PDB entry) 
Domain d1uisa_: 1uis A: [99431]
complexed with acy, ca
Details for d1uisa_
PDB Entry: 1uis (more details), 2 Å
PDB Description: The 2.0 crystal structure of eqFP611, a far-red fluorescent protein from the sea anemone Entacmaea quadricolor
PDB Compounds: (A:) red fluorescent protein FP611SCOPe Domain Sequences for d1uisa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uisa_ d.22.1.1 (A:) Red fluorescent protein fp61 {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
ihmnslikenmrmmvvmegsvngyqfkctgegdgnpymgtqtmrikvveggplpfafdil
atsfmygsktfikhtkgipdffkqsfpegftwervtryedggvftvmqdtsledgclvyh
akvtgvnfpsngavmqkktkgwepntemlypadgglrgysqmalnvdgggylscsfetty
rskktvenfkmpgfhfvdhrlerleesdkemfvvqhehavakfcdlp
SCOPe Domain Coordinates for d1uisa_:
Click to download the PDB-style file with coordinates for d1uisa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uisa_:
- d1uisa_ first appeared in SCOP 1.67
- d1uisa_ appears in SCOPe 2.02
- d1uisa_ appears in SCOPe 2.04
- d1uisa_ appears in the current release, SCOPe 2.08, called d1uisa1
View in 3D
