Lineage for d1uhta_ (1uht A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779760Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 1779761Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 1779795Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 1779814Protein FHA domain containing protein At4G14490 [101624] (1 species)
  7. 1779815Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101625] (1 PDB entry)
  8. 1779816Domain d1uhta_: 1uht A: [99401]
    structural genomics

Details for d1uhta_

PDB Entry: 1uht (more details)

PDB Description: solution structure of the fha domain of arabidopsis thaliana hypothetical protein
PDB Compounds: (A:) expressed protein

SCOPe Domain Sequences for d1uhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gssgssgmvtpslrlvfvkgpregdaldykpgstirvgrivrgneiaikdagistkhlri
esdsgnwviqdlgssngtllnsnaldpetsvnlgdgdviklgeytsilvnfvsgpssg

SCOPe Domain Coordinates for d1uhta_:

Click to download the PDB-style file with coordinates for d1uhta_.
(The format of our PDB-style files is described here.)

Timeline for d1uhta_: