Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Homeodomain-only protein, Hop [109647] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [109648] (1 PDB entry) Uniprot Q8R1H0 |
Domain d1uhsa_: 1uhs A: [107853] |
PDB Entry: 1uhs (more details)
SCOPe Domain Sequences for d1uhsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} gsegaatmtedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrrs eglpsecrsvtd
Timeline for d1uhsa_: