Lineage for d1uhna_ (1uhn A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768689Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 768690Protein Calcineurin B-like protein 2 [101182] (1 species)
  7. 768691Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101183] (2 PDB entries)
  8. 768693Domain d1uhna_: 1uhn A: [99399]
    complexed with ca

Details for d1uhna_

PDB Entry: 1uhn (more details), 2.1 Å

PDB Description: The crystal structure of the calcium binding protein AtCBL2 from Arabidopsis thaliana
PDB Compounds: (A:) calcineurin B-like protein 2

SCOP Domain Sequences for d1uhna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhna_ a.39.1.5 (A:) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dpellardtvfsvseiealyelfkkissaviddglinkeefqlalfktnkkeslfadrvf
dlfdtkhngilgfeefaralsvfhpnapiddkihfsfqlydlkqqgfierqevkqmvvat
laesgmnlkdtviediidktfeeadtkhdgkidkeewrslvlrhpsllknmtlqylkdit
ttfpsfvfh

SCOP Domain Coordinates for d1uhna_:

Click to download the PDB-style file with coordinates for d1uhna_.
(The format of our PDB-style files is described here.)

Timeline for d1uhna_: