![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calcineurin B-like protein 2 [101182] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101183] (2 PDB entries) |
![]() | Domain d1uhna_: 1uhn A: [99399] complexed with ca |
PDB Entry: 1uhn (more details), 2.1 Å
SCOPe Domain Sequences for d1uhna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhna_ a.39.1.5 (A:) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} dpellardtvfsvseiealyelfkkissaviddglinkeefqlalfktnkkeslfadrvf dlfdtkhngilgfeefaralsvfhpnapiddkihfsfqlydlkqqgfierqevkqmvvat laesgmnlkdtviediidktfeeadtkhdgkidkeewrslvlrhpsllknmtlqylkdit ttfpsfvfh
Timeline for d1uhna_: