Lineage for d1ugva_ (1ugv A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1536380Protein Olygophrenin-1 like protein (KIAA0621) [101673] (1 species)
  7. 1536381Species Human (Homo sapiens) [TaxId:9606] [101674] (1 PDB entry)
  8. 1536382Domain d1ugva_: 1ugv A: [99367]
    structural genomics

Details for d1ugva_

PDB Entry: 1ugv (more details)

PDB Description: solution structure of the sh3 domain of human olygophrein-1 like protein (kiaa0621)
PDB Compounds: (A:) Olygophrenin-1 like protein

SCOPe Domain Sequences for d1ugva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgtpfrkakalyackaehdselsftagtvfdnvhpsqepgwlegtlngktglipe
nyveflsgpssg

SCOPe Domain Coordinates for d1ugva_:

Click to download the PDB-style file with coordinates for d1ugva_.
(The format of our PDB-style files is described here.)

Timeline for d1ugva_: