Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins) contains irregular array of helices in the N-terminal extension automatically mapped to Pfam PF02211 |
Protein Cobalt-containing nitrile hydratase [82067] (2 species) |
Species Pseudonocardia thermophila [TaxId:1848] [82068] (5 PDB entries) Uniprot Q7SID3 |
Domain d1ugpb_: 1ugp B: [107832] Other proteins in same PDB: d1ugpa_ complexed with bua, co |
PDB Entry: 1ugp (more details), 1.63 Å
SCOPe Domain Sequences for d1ugpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugpb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]} mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielv
Timeline for d1ugpb_: