Lineage for d1ugpb_ (1ugp B:)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) 
Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
contains irregular array of helices in the N-terminal extension
Protein Cobalt-containing nitrile hydratase [82067] (2 species) Species Pseudonocardia thermophila [TaxId:1848] [82068] (5 PDB entries)
Uniprot Q7SID3
Domain d1ugpb_: 1ugp B: [107832]
Other proteins in same PDB: d1ugpa_
complexed with bua, co
Details for d1ugpb_
PDB Entry: 1ugp (more details), 1.63 Å
PDB Description: crystal structure of co-type nitrile hydratase complexed with n- butyric acid
PDB Compounds: (B:) Nitrile hydratase beta subunitSCOPe Domain Sequences for d1ugpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugpb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielv
SCOPe Domain Coordinates for d1ugpb_:
Click to download the PDB-style file with coordinates for d1ugpb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ugpb_:
- d1ugpb_ first appeared in SCOP 1.69
- d1ugpb_ appears in SCOP 1.75
- d1ugpb_ appears in SCOPe 2.02
- d1ugpb_ appears in the current release, SCOPe 2.08
View in 3D
