Lineage for d1ugpa_ (1ugp A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheetsSuperfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) 
duplication: contains two structural repeatsFamily d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
automatically mapped to Pfam PF02979
Protein Cobalt-containing nitrile hydratase [82799] (2 species) Species Pseudonocardia thermophila [TaxId:1848] [82800] (6 PDB entries)
Uniprot Q7SID2
Domain d1ugpa_: 1ugp A: [107831]
Other proteins in same PDB: d1ugpb_
complexed with bua, co
Details for d1ugpa_
PDB Entry: 1ugp (more details), 1.63 Å
PDB Description: crystal structure of co-type nitrile hydratase complexed with n- butyric acid
PDB Compounds: (A:) Nitrile hydratase alpha subunitSCOPe Domain Sequences for d1ugpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugpa_ d.149.1.1 (A:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcscypwpvlgl
ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
seeelatlvtresmigvepakav
SCOPe Domain Coordinates for d1ugpa_:
Click to download the PDB-style file with coordinates for d1ugpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ugpa_:
- d1ugpa_ first appeared in SCOP 1.69
- d1ugpa_ appears in SCOPe 2.07
View in 3D
