Lineage for d1ug3a2 (1ug3 A:1438-1564)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.1: ARM repeat [48371] (28 families) 
Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
Protein Eukaryotic initiation factor eIF4G [48388] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries) 
Domain d1ug3a2: 1ug3 A:1438-1564 [119672]
gamma 3 isoform; C-terminal domain, containing a W2 region (Pfam PF02020)
applies to all domains of a family if the common domain is composed of a different number of small repeating units
Details for d1ug3a2
PDB Entry: 1ug3 (more details), 2.24 Å
PDB Description: c-terminal portion of human eif4gi
PDB Compounds: (A:) eukaryotic protein synthesis initiation factor 4GSCOPe Domain Sequences for d1ug3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ug3a2 a.118.1.14 (A:1438-1564) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
alpseelnrqlekllkegssnqrvfdwieanlseqqivsntlvralmtavcysaiifetp
lrvdvavlkarakllqkylcdeqkelqalyalqalvvtleqppnllrmffdalydedvvk
edafysw
SCOPe Domain Coordinates for d1ug3a2:
Click to download the PDB-style file with coordinates for d1ug3a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ug3a2:
- d1ug3a2 first appeared in SCOP 1.73
- d1ug3a2 appears in SCOPe 2.07
View in 3D
