Lineage for d1ug3a1 (1ug3 A:1235-1427)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338934Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 2338964Protein Eukaryotic initiation factor eIF4G [48388] (1 species)
  7. 2338965Species Human (Homo sapiens) [TaxId:9606] [48389] (2 PDB entries)
  8. 2338966Domain d1ug3a1: 1ug3 A:1235-1427 [119671]
    gamma 3 isoform; pre C-terminal domain, containing MA3 region (Pfam PF02847)

Details for d1ug3a1

PDB Entry: 1ug3 (more details), 2.24 Å

PDB Description: c-terminal portion of human eif4gi
PDB Compounds: (A:) eukaryotic protein synthesis initiation factor 4G

SCOPe Domain Sequences for d1ug3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug3a1 a.118.1.14 (A:1235-1427) Eukaryotic initiation factor eIF4G {Human (Homo sapiens) [TaxId: 9606]}
kaalseeelekkskaiieeylhlndmkeavqcvqelaspsllfifvrhgvestlersaia
rehmgqllhqllcaghlstaqyyqglyeilelaedmeidiphvwlylaelvtpilqeggv
pmgelfreitkplrplgkaasllleilgllcksmgpkkvgtlwreaglswkeflpegqdi
gafvaeqkveytl

SCOPe Domain Coordinates for d1ug3a1:

Click to download the PDB-style file with coordinates for d1ug3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ug3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ug3a2