Lineage for d1uela_ (1uel A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) 
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
Pfam PF00240
Protein Ubiquitin-like domain of Rad23 homolog B (Hhr23B) [102777] (1 species) Species Human (Homo sapiens) [TaxId:9606] [102778] (2 PDB entries)
Uniprot P54727 1-82
Domain d1uela_: 1uel A: [99265]
Other proteins in same PDB: d1uelb_
complexed with the C-terminal ubiquitin-interacting motif of the proteasome subunit s5a
Details for d1uela_
PDB Entry: 1uel (more details)
PDB Description: solution structure of ubiquitin-like domain of hhr23b complexed with ubiquitin-interacting motif of proteasome subunit s5a
PDB Compounds: (A:) UV excision repair protein RAD23 homolog BSCOPe Domain Sequences for d1uela_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]}
mqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddtalk
eykideknfvvvmvtkpkavstpapatlehhhhhh
SCOPe Domain Coordinates for d1uela_:
Click to download the PDB-style file with coordinates for d1uela_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uela_:
- d1uela_ first appeared in SCOP 1.67
- d1uela_ appears in SCOPe 2.03
- d1uela_ appears in SCOPe 2.05
- d1uela_ appears in the current release, SCOPe 2.08, called d1uela1
View in 3D
