Lineage for d1ueha_ (1ueh A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) 
the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinaseFamily c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
automatically mapped to Pfam PF01255
Protein Undecaprenyl diphosphate synthase [64007] (3 species) Species Escherichia coli [TaxId:562] [64009] (17 PDB entries) 
Domain d1ueha_: 1ueh A: [99259]
complexed with mg, oxn, so4, unl
Details for d1ueha_
PDB Entry: 1ueh (more details), 1.73 Å
PDB Description: E. coli undecaprenyl pyrophosphate synthase in complex with Triton X-100, magnesium and sulfate
PDB Compounds: (A:) undecaprenyl pyrophosphate synthaseSCOPe Domain Sequences for d1ueha_:
Sequence, based on SEQRES records: (download)
>d1ueha_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafss
enwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealta
gntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlv
irtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
Sequence, based on observed residues (ATOM records): (download)
>d1ueha_ c.101.1.1 (A:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsm
elfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyg
grwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfll
wqiayaelyftdvlwpdfdeqdfegalnafanre
SCOPe Domain Coordinates for d1ueha_:
Click to download the PDB-style file with coordinates for d1ueha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ueha_:
- d1ueha_ first appeared in SCOP 1.67
- d1ueha_ appears in SCOPe 2.07
View in 3D
