Lineage for d1ueba2 (1ueb A:64-126)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789113Protein Elongation factor P middle and C-terminal domains [110196] (1 species)
    duplication: contains two domains of this fold
  7. 1789114Species Thermus thermophilus HB8 [TaxId:300852] [110197] (1 PDB entry)
    Uniprot Q76G20
  8. 1789115Domain d1ueba2: 1ueb A:64-126 [107783]
    Other proteins in same PDB: d1ueba1, d1uebb1

Details for d1ueba2

PDB Entry: 1ueb (more details), 1.65 Å

PDB Description: Crystal structure of translation elongation factor P from Thermus thermophilus HB8
PDB Compounds: (A:) elongation factor P

SCOPe Domain Sequences for d1ueba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ueba2 b.40.4.5 (A:64-126) Elongation factor P middle and C-terminal domains {Thermus thermophilus HB8 [TaxId: 300852]}
yvetrelqylypegeemvfmdletyeqfavprsrvvgaeffkegmtalgdmyegqpikvt
ppt

SCOPe Domain Coordinates for d1ueba2:

Click to download the PDB-style file with coordinates for d1ueba2.
(The format of our PDB-style files is described here.)

Timeline for d1ueba2: