Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein Elongation factor P middle and C-terminal domains [110196] (1 species) duplication: contains two domains of this fold |
Species Thermus thermophilus HB8 [TaxId:300852] [110197] (1 PDB entry) Uniprot Q76G20 |
Domain d1ueba2: 1ueb A:64-126 [107783] Other proteins in same PDB: d1ueba1, d1uebb1 |
PDB Entry: 1ueb (more details), 1.65 Å
SCOPe Domain Sequences for d1ueba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ueba2 b.40.4.5 (A:64-126) Elongation factor P middle and C-terminal domains {Thermus thermophilus HB8 [TaxId: 300852]} yvetrelqylypegeemvfmdletyeqfavprsrvvgaeffkegmtalgdmyegqpikvt ppt
Timeline for d1ueba2: