Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
Protein ssDNA-binding protein [50264] (4 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [101760] (4 PDB entries) |
Domain d1ue6b_: 1ue6 B: [99248] has additional insertions and/or extensions that are not grouped together missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1ue6 (more details), 2.7 Å
SCOPe Domain Sequences for d1ue6b_:
Sequence, based on SEQRES records: (download)
>d1ue6b_ b.40.4.3 (B:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} gdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwre aaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkasr sgg
>d1ue6b_ b.40.4.3 (B:) ssDNA-binding protein {Mycobacterium tuberculosis [TaxId: 1773]} gdttitivgnltadpelrftpsgaavanftvastpriealflrcniwreaaenvaesltr garvivsgrlkqrsfettvievevdeigpslryatakvnkasrsgg
Timeline for d1ue6b_: