Lineage for d1udva_ (1udv A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523683Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2524018Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2524019Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 2524020Protein DNA-binding protein AlbA [82706] (4 species)
    an archaeal chromatin protein modulated by acetylation, a Sir2 substrate
  7. 2524031Species Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (3 PDB entries)
    gene SSO6877 (AlbA2)
  8. 2524034Domain d1udva_: 1udv A: [99224]
    complexed with zn

Details for d1udva_

PDB Entry: 1udv (more details), 1.85 Å

PDB Description: Crystal structure of the hyperthermophilic archaeal dna-binding protein Sso10b2 at 1.85 A
PDB Compounds: (A:) DNA binding protein sso10b

SCOPe Domain Sequences for d1udva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udva_ d.68.6.1 (A:) DNA-binding protein AlbA {Sulfolobus solfataricus, Sso10b2 [TaxId: 2287]}
teklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgv
qlvnvqtgsevrdrrrisyillrlkrvy

SCOPe Domain Coordinates for d1udva_:

Click to download the PDB-style file with coordinates for d1udva_.
(The format of our PDB-style files is described here.)

Timeline for d1udva_: