Lineage for d1udva_ (1udv A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.68: IF3-like [55199] (8 superfamilies)
beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
Superfamily d.68.6: AlbA-like [82704] (3 families) 
Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins) 
Protein DNA-binding protein AlbA [82706] (4 species)
an archaeal chromatin protein modulated by acetylation, a Sir2 substrateSpecies Sulfolobus solfataricus, Sso10b2 [TaxId:2287] [103058] (3 PDB entries)
gene SSO6877 (AlbA2)
Domain d1udva_: 1udv A: [99224]
complexed with zn
Details for d1udva_
PDB Entry: 1udv (more details), 1.85 Å
PDB Description: Crystal structure of the hyperthermophilic archaeal dna-binding protein Sso10b2 at 1.85 A
PDB Compounds: (A:) DNA binding protein sso10bSCOPe Domain Sequences for d1udva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udva_ d.68.6.1 (A:) DNA-binding protein AlbA {Sulfolobus solfataricus, Sso10b2 [TaxId: 2287]}
teklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgv
qlvnvqtgsevrdrrrisyillrlkrvy
SCOPe Domain Coordinates for d1udva_:
Click to download the PDB-style file with coordinates for d1udva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1udva_:
- d1udva_ first appeared in SCOP 1.67
- d1udva_ appears in SCOPe 2.07
View in 3D
