SCOPe 2.04: Domain d1ud9a1: 1ud9 A:1-119

Lineage for d1ud9a1 (1ud9 A:1-119)

Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
Fold d.131: DNA clamp [55978] (1 superfamily)
contains two helices and two beta sheets
duplication: fold has internal pseudo two-fold symmetry
Superfamily d.131.1: DNA clamp [55979] (3 families)
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
duplication: consists of two domains of this fold
Protein Proliferating cell nuclear antigen (PCNA) [55989] (6 species)
Species Sulfolobus tokodaii [TaxId:111955] [111175] (1 PDB entry)
Uniprot Q975N2
Domain d1ud9a1: 1ud9 A:1-119 [107768]
complexed with zn

Details for d1ud9a1

PDB Entry: 1ud9 (more details), 1.68 Å

PDB Description: Crystal Structure of Proliferating Cell Nuclear Antigen (PCNA) Homolog From Sulfolobus tokodaii

PDB Compounds: (A:) DNA polymerase sliding clamp A

SCOPe Domain Sequences for d1ud9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ud9a1 d.131.1.2 (A:1-119) Proliferating cell nuclear antigen (PCNA) {Sulfolobus tokodaii [TaxId: 111955]}
ahivyddvrdlkaiiqallklvdealfdikpegiqlvaidkahislikielpkemfkeyd
vpeefkfgfntqymskllkaakrkeeiiidadspevvkltlsgalnrvfnvnnievlpp

SCOPe Domain Coordinates for d1ud9a1:

Click to download the PDB-style file with coordinates for d1ud9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ud9a1: