Lineage for d1ud2a1 (1ud2 A:391-480)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Bacterial alpha-Amylase [51013] (9 species) 
Species Bacillus sp., ksm-k38 [TaxId:1409] [89382] (6 PDB entries) 
Domain d1ud2a1: 1ud2 A:391-480 [88469]
Other proteins in same PDB: d1ud2a2
complexed with gol, na
Details for d1ud2a1
PDB Entry: 1ud2 (more details), 2.13 Å
PDB Description: Crystal structure of calcium-free alpha-amylase from Bacillus sp. strain KSM-K38 (AmyK38)
PDB Compounds: (A:) amylaseSCOPe Domain Sequences for d1ud2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud2a1 b.71.1.1 (A:391-480) Bacterial alpha-Amylase {Bacillus sp., ksm-k38 [TaxId: 1409]}
yaygtqhdyfdhwdvvgwtregsssrpnsglatimsngpggskwmyvgrqnagqtwtdlt
gnngasvtingdgwgefftnggsvsvyvnq
SCOPe Domain Coordinates for d1ud2a1:
Click to download the PDB-style file with coordinates for d1ud2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ud2a1:
- d1ud2a1 first appeared in SCOP 1.65
- d1ud2a1 appears in SCOPe 2.06
- d1ud2a1 appears in the current release, SCOPe 2.08
View in 3D
