| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species) |
| Species Escherichia coli [TaxId:562] [102436] (5 PDB entries) |
| Domain d1uc7a_: 1uc7 A: [99163] disulfide-linked complex with the N-terminal domain |
PDB Entry: 1uc7 (more details), 1.9 Å
SCOPe Domain Sequences for d1uc7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uc7a_ c.47.1.1 (A:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
aqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkala
dtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlr
drqp
Timeline for d1uc7a_: