Lineage for d1uc7a_ (1uc7 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.1: Thioltransferase [52834] (16 proteins) 
Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species) Species Escherichia coli [TaxId:562] [102436] (5 PDB entries) 
Domain d1uc7a_: 1uc7 A: [99163]
disulfide-linked complex with the N-terminal domain
Details for d1uc7a_
PDB Entry: 1uc7 (more details), 1.9 Å
PDB Description: Crystal structure of DsbDgamma
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbDSCOPe Domain Sequences for d1uc7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uc7a_ c.47.1.1 (A:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
aqtqthlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkala
dtvllqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlr
drqp
SCOPe Domain Coordinates for d1uc7a_:
Click to download the PDB-style file with coordinates for d1uc7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uc7a_:
- d1uc7a_ first appeared in SCOP 1.67
- d1uc7a_ appears in SCOPe 2.07
View in 3D
