Lineage for d1ubhl_ (1ubh L:)
- Root: SCOP 1.73
Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds) 
Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
3 domains: (1) all-alpha; (2&3) alpha+betaSuperfamily e.18.1: HydB/Nqo4-like [56762] (2 families) 
Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (1 protein) Protein Nickel-iron hydrogenase, large subunit [56764] (5 species) Species Desulfovibrio vulgaris [TaxId:881] [56766] (16 PDB entries) 
Domain d1ubhl_: 1ubh L: [88418]
Other proteins in same PDB: d1ubhs_
complexed with cmo, fne, fs3, fs4, mg, mpd
Details for d1ubhl_
PDB Entry: 1ubh (more details), 1.35 Å
PDB Description: three-dimensional structure of the carbon monoxide complex of [nife]hydrogenase from desulufovibrio vulgaris miyazaki f
PDB Compounds: (L:) Periplasmic [NiFe] hydrogenase Large subunitSCOP Domain Sequences for d1ubhl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubhl_ e.18.1.1 (L:) Nickel-iron hydrogenase, large subunit {Desulfovibrio vulgaris [TaxId: 881]}
ssysgpivvdpvtrieghlrievevengkvknayssstlfrgleiilkgrdprdaqhftq
rtcgvctythalastrcvdnavgvhipknatyirnlvlgaqylhdhivhfyhlhaldfvd
vtaalkadpakaakvassisprkttaadlkavqdklktfvetgqlgpftnayflgghpay
yldpetnliatahylealrlqvkaaramavfgaknphtqftvvggvtcydaltpqriaef
ealwketkafvdevyipdllvvaaaykdwtqyggtdnfitfgefpkdeydlnsrffkpgv
vfkrdfknikpfdkmqieehvrhswyegaearhpwkgqtqpkytdlhgddryswmkapry
mgepmetgplaqvliaysqghpkvkavtdavlaklgvgpealfstlgrtaargietavia
eyvgvmlqeykdniakgdnvicapwempkqaegvgfvnaprgglshwiriedgkignfql
vvpstwtlgprcdknklspveasligtpvadakrpveilrtvhsfdpciacgvh
SCOP Domain Coordinates for d1ubhl_:
Click to download the PDB-style file with coordinates for d1ubhl_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ubhl_:
- d1ubhl_ first appeared in SCOP 1.65
- d1ubhl_ appears in SCOP 1.71
- d1ubhl_ appears in SCOP 1.75
- d1ubhl_ appears in the current release, SCOPe 2.08
View in 3D
