Lineage for d1ub7a1 (1ub7 A:2-173)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627154Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)
  6. 1627282Protein Ketoacyl-ACP synthase III (FabH) [53912] (3 species)
  7. 1627359Species Thermus thermophilus [TaxId:274] [89794] (1 PDB entry)
  8. 1627360Domain d1ub7a1: 1ub7 A:2-173 [88402]
    complexed with gol

Details for d1ub7a1

PDB Entry: 1ub7 (more details), 2.3 Å

PDB Description: The Crystal Analysis of Beta-Keroacyl-[Acyl Carrier Protein] Synthase III (FABH)From Thermus Thermophilus.
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier protein] synthase

SCOPe Domain Sequences for d1ub7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]}
sgilalgayvpervmtnadfeayldtsdewivtrtgikerrvaaedeytsdlafkavedl
lrrhpgalegvdavivatntpdalfpdtaalvqarfglkafaydllagcpgwiyalaqah
alveaglaqkvlavgaealskiidwndratavlfgdgggaavvgkvregygf

SCOPe Domain Coordinates for d1ub7a1:

Click to download the PDB-style file with coordinates for d1ub7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ub7a1: