Lineage for d1ub3b_ (1ub3 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443124Protein Deoxyribose-phosphate aldolase DeoC [69394] (6 species)
  7. 2443149Species Thermus thermophilus [TaxId:274] [89492] (2 PDB entries)
  8. 2443151Domain d1ub3b_: 1ub3 B: [88396]
    structural genomics
    complexed with hpd

Details for d1ub3b_

PDB Entry: 1ub3 (more details), 1.4 Å

PDB Description: Crystal Structure of Tetrameric Structure of Aldolase from thermus thermophilus HB8
PDB Compounds: (B:) Aldolase protein

SCOPe Domain Sequences for d1ub3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ub3b_ c.1.10.1 (B:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]}
mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
aaggirdretalrmlkagasrlgtssgvalv

SCOPe Domain Coordinates for d1ub3b_:

Click to download the PDB-style file with coordinates for d1ub3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ub3b_: