Lineage for d1uaxa_ (1uax A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (16 families) 
consists of one domain of this fold
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) 
Protein Class II ribonuclease H (RNase HII) [53103] (5 species) 
Species Pyrococcus horikoshii [TaxId:53953] [110639] (2 PDB entries)
Uniprot O59351
Domain d1uaxa_: 1uax A: [107764]
Details for d1uaxa_
PDB Entry: 1uax (more details), 2 Å
PDB Description: Crystal structure of the ribonuclease H2 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) ribonuclease hiiSCOPe Domain Sequences for d1uaxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uaxa_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Pyrococcus horikoshii [TaxId: 53953]}
mkvagvdeagrgpvigplvigvavideknierlrdigvkdskqltpgqreklfsklidil
ddyyvllvtpkeiderhhsmneleaekfvvalnslrikpqkiyvdsadvdpkrfaslika
glkyeatviaehkadakyeivsaasiiakvtrdreieklkqkygefgsgypsdprtkewl
eeyykqygdfppivrrtwetarkieerfrkn
SCOPe Domain Coordinates for d1uaxa_:
Click to download the PDB-style file with coordinates for d1uaxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uaxa_:
- d1uaxa_ first appeared in SCOP 1.69
- d1uaxa_ appears in SCOPe 2.06
- d1uaxa_ appears in the current release, SCOPe 2.08
View in 3D
