Lineage for d1uasa2 (1uas A:1-273)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830250Protein Melibiase [75064] (4 species)
  7. 2830297Species Rice (Oryza sativa) [TaxId:4530] [89468] (1 PDB entry)
    alpha-galactosidase
  8. 2830298Domain d1uasa2: 1uas A:1-273 [88389]
    Other proteins in same PDB: d1uasa1
    complexed with gla, gol, pt, so4
    missing some secondary structures that made up less than one-third of the common domain

Details for d1uasa2

PDB Entry: 1uas (more details), 1.5 Å

PDB Description: crystal structure of rice alpha-galactosidase
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d1uasa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uasa2 c.1.8.1 (A:1-273) Melibiase {Rice (Oryza sativa) [TaxId: 4530]}
fenglgrtpqmgwnswnhfycgineqiiretadalvntglaklgyqyvniddcwaeysrd
sqgnfvpnrqtfpsgikaladyvhakglklgiysdagsqtcsnkmpgsldheeqdvktfa
swgvdylkydncndagrsvmerytrmsnamktygkniffslcewgkenpatwagrmgnsw
rttgdiadnwgsmtsradendqwaayagpggwndpdmlevgnggmseaeyrshfsiwala
kaplligcdvrsmsqqtknilsnseviavnqds

SCOPe Domain Coordinates for d1uasa2:

Click to download the PDB-style file with coordinates for d1uasa2.
(The format of our PDB-style files is described here.)

Timeline for d1uasa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uasa1