Lineage for d1u9ya2 (1u9y A:156-284)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891815Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins)
    duplication: consists of two domains of this fold
  6. 2891816Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species)
  7. 2891830Species Methanocaldococcus jannaschii [TaxId:2190] [142562] (2 PDB entries)
    Uniprot Q58761 1-155! Uniprot Q58761 156-284
  8. 2891832Domain d1u9ya2: 1u9y A:156-284 [119656]

Details for d1u9ya2

PDB Entry: 1u9y (more details), 2.65 Å

PDB Description: Crystal Structure of Phosphoribosyl Diphosphate Synthase from Methanocaldococcus jannaschii
PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d1u9ya2:

Sequence, based on SEQRES records: (download)

>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]}
dpivlapdkgalefaktaskilnaeydylektrlspteiqiapktldakdrdvfivddii
stggtmatavkllkeqgakkiiaacvhpvligdalnklysagveevvgtdtylsevskvs
vaevivdll

Sequence, based on observed residues (ATOM records): (download)

>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]}
dpivlapdkgalefaktaskilnaeydyleiapktldakdrdvfivddiistggtmatav
kllkeqgakkiiaacvhpvligdalnklysagveevvgtdtylsevskvsvaevivdll

SCOPe Domain Coordinates for d1u9ya2:

Click to download the PDB-style file with coordinates for d1u9ya2.
(The format of our PDB-style files is described here.)

Timeline for d1u9ya2: