Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins) duplication: consists of two domains of this fold |
Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species) |
Species Methanocaldococcus jannaschii [TaxId:2190] [142562] (2 PDB entries) Uniprot Q58761 1-155! Uniprot Q58761 156-284 |
Domain d1u9ya1: 1u9y A:1-155 [119655] |
PDB Entry: 1u9y (more details), 2.65 Å
SCOPe Domain Sequences for d1u9ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9ya1 c.61.1.2 (A:1-155) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} mivvsgsqsqnlafkvakllntkltrveykrfpdneiyvrivdeinddeaviintqknqn daivetillcdalrdegvkkitlvapylayarqdkkfnpgeaisiralakiysnivdkli tinphethikdfftipfiygdavpklaeyvkdkln
Timeline for d1u9ya1: