Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) contains one classic and one pseudo HhH motifs |
Family a.60.4.2: NusA extra C-terminal domains [109873] (2 proteins) |
Protein Transcription elongation protein NusA [109874] (1 species) |
Species Escherichia coli [TaxId:562] [109875] (1 PDB entry) Uniprot P03003 352-419 |
Domain d1u9lb_: 1u9l B: [107752] complexed with au |
PDB Entry: 1u9l (more details), 1.9 Å
SCOPe Domain Sequences for d1u9lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9lb_ a.60.4.2 (B:) Transcription elongation protein NusA {Escherichia coli [TaxId: 562]} ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak nalatiaqaq
Timeline for d1u9lb_: