Lineage for d1u9lb_ (1u9l B:)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.60: SAM domain-like [47768] (16 superfamilies)
4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) 
contains one classic and one pseudo HhH motifs
Family a.60.4.2: NusA extra C-terminal domains [109873] (1 protein) Protein Transcription elongation protein NusA [109874] (1 species) Species Escherichia coli [TaxId:562] [109875] (2 PDB entries)
Uniprot P03003 352-419
Domain d1u9lb_: 1u9l B: [107752]
complexed with au
Details for d1u9lb_
PDB Entry: 1u9l (more details), 1.9 Å
PDB Description: Structural basis for a NusA- protein N interaction
PDB Compounds: (B:) Transcription elongation protein nusASCOPe Domain Sequences for d1u9lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9lb_ a.60.4.2 (B:) Transcription elongation protein NusA {Escherichia coli [TaxId: 562]}
ahaaidtftkyldidedfatvlveegfstleelayvpmkelleiegldeptvealrerak
nalatiaqaq
SCOPe Domain Coordinates for d1u9lb_:
Click to download the PDB-style file with coordinates for d1u9lb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u9lb_:
- d1u9lb_ first appeared in SCOP 1.69
- d1u9lb_ appears in SCOPe 2.02
- d1u9lb_ appears in SCOPe 2.04
- d1u9lb_ appears in the current release, SCOPe 2.08
View in 3D
