Lineage for d1u8sa1 (1u8s A:2-87)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863190Superfamily d.58.18: ACT-like [55021] (14 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 863273Family d.58.18.5: Glycine cleavage system transcriptional repressor [110980] (1 protein)
    tandem repeat of two ACT-like domains; swapped domain dimer
  6. 863274Protein putative transcriptional repressor VC2159 [110981] (1 species)
  7. 863275Species Vibrio cholerae [TaxId:666] [110982] (1 PDB entry)
    Uniprot Q9KQ45
  8. 863276Domain d1u8sa1: 1u8s A:2-87 [107737]
    Structural genomics target

Details for d1u8sa1

PDB Entry: 1u8s (more details), 2.45 Å

PDB Description: Crystal structure of putative glycine cleavage system transcriptional repressor
PDB Compounds: (A:) glycine cleavage system transcriptional repressor, putative

SCOP Domain Sequences for d1u8sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]}
sltqhlvitavgtdrpgicnevvrlvtqagcniidsriamfgkeftllmlisgspsnitr
vettlpllgqqhdlitmmkrtsphdh

SCOP Domain Coordinates for d1u8sa1:

Click to download the PDB-style file with coordinates for d1u8sa1.
(The format of our PDB-style files is described here.)

Timeline for d1u8sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u8sa2