Lineage for d1u7ka_ (1u7k A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772125Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 772126Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 772127Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (5 proteins)
  6. 772128Protein AKV capsid [116949] (1 species)
  7. 772129Species AKV murine leukemia virus [TaxId:11791] [116950] (1 PDB entry)
    Uniprot P03336 215-345 # fragment of the core shell protein p30 (215-477)
  8. 772130Domain d1u7ka_: 1u7k A: [113087]

Details for d1u7ka_

PDB Entry: 1u7k (more details), 1.85 Å

PDB Description: Structure of a hexameric N-terminal domain from murine leukemia virus capsid
PDB Compounds: (A:) gag polyprotein

SCOP Domain Sequences for d1u7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7ka_ a.73.1.1 (A:) AKV capsid {AKV murine leukemia virus [TaxId: 11791]}
plrmggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdyttqrgrnhlvlyrq
lllagmqnagr

SCOP Domain Coordinates for d1u7ka_:

Click to download the PDB-style file with coordinates for d1u7ka_.
(The format of our PDB-style files is described here.)

Timeline for d1u7ka_: