![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily) metal(zinc)-bound fold |
![]() | Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) ![]() |
![]() | Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins) |
![]() | Protein Zinc finger protein ncp10 [57765] (3 species) |
![]() | Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [57766] (2 PDB entries) Uniprot P03332 479-534 |
![]() | Domain d1u6pa_: 1u6p A: [113073] protein/RNA complex; complexed with zn |
PDB Entry: 1u6p (more details)
SCOPe Domain Sequences for d1u6pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6pa_ g.40.1.1 (A:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} atvvsgqkqdrqggerrrsqldrdqcayckekghwakdcpkkprgprgprpqtsll
Timeline for d1u6pa_: