Lineage for d1u6pa_ (1u6p A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262864Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 2262865Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 2262866Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins)
  6. 2262894Protein Zinc finger protein ncp10 [57765] (2 species)
  7. 2262897Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [57766] (2 PDB entries)
    Uniprot P03332 479-534
  8. 2262899Domain d1u6pa_: 1u6p A: [113073]
    protein/RNA complex; complexed with zn

Details for d1u6pa_

PDB Entry: 1u6p (more details)

PDB Description: NMR Structure of the MLV encapsidation signal bound to the Nucleocapsid protein
PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d1u6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6pa_ g.40.1.1 (A:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
atvvsgqkqdrqggerrrsqldrdqcayckekghwakdcpkkprgprgprpqtsll

SCOPe Domain Coordinates for d1u6pa_:

Click to download the PDB-style file with coordinates for d1u6pa_.
(The format of our PDB-style files is described here.)

Timeline for d1u6pa_: