Lineage for d1u6dx_ (1u6d X:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2418094Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2418095Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2418096Protein Kelch-like ECH-associated protein 1, KEAP1 [117283] (2 species)
  7. 2418097Species Human (Homo sapiens) [TaxId:9606] [117284] (3 PDB entries)
    Uniprot Q14145 322-609
  8. 2418100Domain d1u6dx_: 1u6d X: [113061]

Details for d1u6dx_

PDB Entry: 1u6d (more details), 1.85 Å

PDB Description: Crystal structure of the Kelch domain of human Keap1
PDB Compounds: (X:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d1u6dx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u6dx_ b.68.11.1 (X:) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}
pkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrn
nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve
ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit
amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv
hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d1u6dx_:

Click to download the PDB-style file with coordinates for d1u6dx_.
(The format of our PDB-style files is described here.)

Timeline for d1u6dx_: