![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.11: Kelch motif [117281] (2 families) ![]() |
![]() | Family b.68.11.1: Kelch motif [117282] (2 proteins) Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967) |
![]() | Protein Kelch-like ECH-associated protein 1, KEAP1 [117283] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117284] (3 PDB entries) Uniprot Q14145 322-609 |
![]() | Domain d1u6dx_: 1u6d X: [113061] |
PDB Entry: 1u6d (more details), 1.85 Å
SCOPe Domain Sequences for d1u6dx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u6dx_ b.68.11.1 (X:) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} pkvgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrn nspdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsve ryeperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmit amntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitv hqgriyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt
Timeline for d1u6dx_: