Lineage for d1u4ga_ (1u4g A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1660649Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 1660653Protein Elastase [63413] (1 species)
  7. 1660654Species Pseudomonas aeruginosa [TaxId:287] [55492] (4 PDB entries)
    Uniprot P14756 198-495
  8. 1660655Domain d1u4ga_: 1u4g A: [107670]
    complexed with ca, hpi, so4, zn

Details for d1u4ga_

PDB Entry: 1u4g (more details), 1.4 Å

PDB Description: Elastase of Pseudomonas aeruginosa with an inhibitor
PDB Compounds: (A:) elastase

SCOPe Domain Sequences for d1u4ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4ga_ d.92.1.2 (A:) Elastase {Pseudomonas aeruginosa [TaxId: 287]}
aeaggpggnqkigkytygsdygplivndrcemddgnvitvdmnsstddskttpfrfacpt
ntykqvngaysplndahffggvvfklyrdwfgtsplthklymkvhygrsvenaywdgtam
lfgdgatmfyplvsldvaahevshgfteqnsgliyrgqsggmneafsdmageaaefymrg
kndfligydikkgsgalrymdqpsrdgrsidnasqyyngidvhhssgvynrafyllansp
gwdtrkafevfvdanryywtatsnynsgacgvirsaqnrnysaadvtrafstvgvtcp

SCOPe Domain Coordinates for d1u4ga_:

Click to download the PDB-style file with coordinates for d1u4ga_.
(The format of our PDB-style files is described here.)

Timeline for d1u4ga_: