![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.3: ADP-specific Phosphofructokinase/Glucokinase [64147] (3 proteins) Pfam PF04587 |
![]() | Protein ADP-specific phosphofructokinase [110707] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [110708] (1 PDB entry) Uniprot O59355 # PH1645 |
![]() | Domain d1u2xa_: 1u2x A: [107622] complexed with so4 |
PDB Entry: 1u2x (more details), 2 Å
SCOPe Domain Sequences for d1u2xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2xa_ c.72.1.3 (A:) ADP-specific phosphofructokinase {Pyrococcus horikoshii [TaxId: 53953]} mipehlsiytaynanidaivklnqetiqnlinafdpdevkrrieeypreinepidfvarl vhtlklgkpaavplvnekmnewfdktfryeeerlggqagiiantlaglkirkviaytpfl pkrlaelfkkgvlypvvengelqfkpiqeayregdplkinrifefrkglkfklgdetiei pnsgrfivsarfesisrietredikpflgeigkevdgaifsgyqglrtkysdgkdanyyl rrakediiefkekdvkihvefasvqdrklrkkiitnilpfvdsvgideaeiaqilsvlgy reladriftynrledsilggmiildelnfeilqvhttyylmyithrdnplseeelaksle fgttlaaaraslgdirgpddykvglkvpfnerseyvklrfeeaksrlrmreykvvviptr lvqnpvltvglgdtisagafltyleflkrh
Timeline for d1u2xa_: