Lineage for d1u2fa_ (1u2f A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1027963Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1028328Protein Splicing factor U2AF 65 KDa subunit [54936] (1 species)
  7. 1028329Species Human (Homo sapiens) [TaxId:9606] [54937] (4 PDB entries)
  8. 1028333Domain d1u2fa_: 1u2f A: [39168]
    first RNA-binding domain

Details for d1u2fa_

PDB Entry: 1u2f (more details)

PDB Description: solution structure of the first rna-binding domain of hu2af65
PDB Compounds: (A:) protein (splicing factor u2af 65 kd subunit)

SCOPe Domain Sequences for d1u2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}
arrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflefrsvde
ttqamafdgiifqgqslkirrphdyqplpg

SCOPe Domain Coordinates for d1u2fa_:

Click to download the PDB-style file with coordinates for d1u2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1u2fa_: