Lineage for d1u1ya_ (1u1y A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569071Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 2569072Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 2569073Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 2569122Protein MS2 virus coat protein [55407] (1 species)
  7. 2569123Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
    Uniprot P03612
  8. 2569173Domain d1u1ya_: 1u1y A: [112965]
    protein/RNA complex

Details for d1u1ya_

PDB Entry: 1u1y (more details), 2.85 Å

PDB Description: Crystal structure of a complex between WT bacteriophage MS2 coat protein and an F5 aptamer RNA stemloop with 2aminopurine substituted at the-10 position
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d1u1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1ya_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d1u1ya_:

Click to download the PDB-style file with coordinates for d1u1ya_.
(The format of our PDB-style files is described here.)

Timeline for d1u1ya_: