![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.4: ITPase-like [52972] (4 families) ![]() formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
![]() | Family c.51.4.3: YjjX-like [110621] (2 proteins) Pfam PF01931 |
![]() | Protein Hypothetical protein YjjX [110622] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [110623] (1 PDB entry) Uniprot P39432 |
![]() | Domain d1u14a_: 1u14 A: [107579] Structural genomics target complexed with po4 |
PDB Entry: 1u14 (more details), 1.68 Å
SCOPe Domain Sequences for d1u14a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u14a_ c.51.4.3 (A:) Hypothetical protein YjjX {Salmonella typhimurium [TaxId: 90371]} amhqvisattnpakiqailqafeeifgegschitpvavesgvpeqpfgseetragarnrv dnarrlhpqadfwvaieagidddatfswvvidngvqrgearsatlplpavildrvrqgea lgpvmsqytgideigrkegaigvftagkltrssvyyqavilalspfhna
Timeline for d1u14a_: